Protein basic information
LiverAtlas Protein ID |
HuLPr49601 |
Uniprot ID |
|
Uniprot Acc |
C9JD35; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION: The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MKILLVFDFDNTIIDDNSDTWIVQCAPNKKLPIELRDSYR KGFWTEFMG |
Database cross reference |
RefSeq Protein accession:NP_001186219
|
Ontology annotation
GO-F |
GO:0016791; F:phosphatase activity; IEA:InterPro. |