Protein basic information
LiverAtlas Protein ID |
HuLPr49631 |
Uniprot ID |
|
Uniprot Acc |
C9JSI7; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION: The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAW DVPTQDCGPRLKVPLDLNAFDVQASPNEGFVNQNIT |
Database cross reference |
RefSeq Protein accession:NP_003764
|
Ontology annotation
GO-F |
GO:0004415; F:hyalurononglucosaminidase activity; IEA:InterPro. |