Protein basic information
LiverAtlas Protein ID |
HuLPr49793 |
Uniprot ID |
|
Uniprot Acc |
E5RJY9; |
Protein name |
Uncharacterized protein |
Comment |
CAUTION: The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Gene name |
|
Protein sequence
|
MARRLLPAHVQESVTFRDVAVFFSQDEWLHLDSAQRALYR E |
Database cross reference |
RefSeq Protein accession:NP_001129588
|
Ontology annotation
GO-C |
GO:0005622; C:intracellular; IEA:InterPro. |
GO-F |
GO:0003676; F:nucleic acid binding; IEA:InterPro. |
GO-P |
GO:0006355; P:regulation of transcription, DNA-dependent; IEA:InterPro. |