Protein basic information
LiverAtlas Protein ID |
HuLPr49847 |
Uniprot ID |
|
Uniprot Acc |
E9PLZ7; |
Protein name |
Uncharacterized protein |
Comment |
SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein (By similarity).||SIMILARITY: Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.||CAUTION: The sequence shown here is derived from an Ensembl automatic analysis pipeline and should be considered as preliminary data. |
Subcellular localization |
Membrane; Multi-pass membrane protein (By similarity). |
Gene name |
solute carrier family 5 (sodium/glucose cotransporter), member 12 |
Protein sequence
|
MVVMIVGFLTVLIQGSTHAGGFHNVLEQSTNGSRLHIFDF DVDPLRRHTFWTITVGGTFTWLGIYGVNQSTIQRCISCK TEKHAKLALYFNLLGLWIILVCAVFSGLIMYSHFKDCDP WTSGIISAPDQLMPYFVMEIFATMPGLPGLFVA |
Database cross reference |
RefSeq Protein accession:NP_848593
|
Ontology annotation
GO-C |
GO:0016020; C:membrane; IEA:InterPro. |
GO-F |
GO:0005215; F:transporter activity; IEA:InterPro. |
GO-P |
GO:0055085; P:transmembrane transport; IEA:InterPro. |