Protein basic information
| LiverAtlas Protein ID |
HuLPr50093 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q9H0Z9;A6NDK1;A6NMU6;Q15350;Q15351;Q9BYK3;Q9BYK4; |
|
Protein name |
RNA-binding protein 38 |
|
Comment |
FUNCTION: RNA-binding protein that specifically bind the 3'-UTR of CDKN1A transcripts, leading to maintain the stability of CDKN1A transcripts, thereby acting as a mediator of the p53/TP53 family to regulate CDKN1A. CDKN1A is a cyclin-dependent kinase inhibitor transcriptionally regulated by the p53/TP53 family to induce cell cycle arrest. Isoform 1, but not isoform 2, has the ability to induce cell cycle arrest in G1 and maintain the stability of CDKN1A transcripts induced by p53/TP53. Also acts as a mRNA splicing factor. Specifically regulates the expression of FGFR2- IIIb, an epithelial cell-specific isoform of FGFR2. Plays a role in myogenic differentiation.||SUBCELLULAR LOCATION: Cytoplasm, cytosol. Nucleus.||ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; Synonyms=RNPC1a; IsoId=Q9H0Z9-1; Sequence=Displayed; Name=2; Synonyms=RNPC1b; IsoId=Q9H0Z9-2; Sequence=VSP 035881;||INDUCTION: By p53/TP53 family. Directly induced by p53/TP53, TP63/p63 and TP73/p |
|
Subcellular localization |
Cytoplasm, cytosol. Nucleus. |
|
Gene name |
|
|
Protein sequence
|
MLLQPAPCAPSAGFPRPLAAPGAMHGSQKDTTFTKIFVGG LPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGF VTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSL QTGFAIGVQQLHPTLIQRTYGLTPHYIYPPAIVQPSVVI PAAPVPSLSSPYIEYTPASPAYAQYPPATYDQYPYAASP ATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQLQPDRMQ |
|
Database cross reference |
RefSeq Protein accession:NP_059965
|
Ontology annotation
| GO-C |
GO:0005829; C:cytosol; IDA:UniProtKB. GO:0005829; C:cytosol; IEA:UniProtKB-SubCell. GO:0005634; C:nucleus; IDA:UniProtKB. GO:0005634; C:nucleus; IEA:UniProtKB-SubCell. |
|
GO-F |
GO:0003730; F:mRNA 3'-UTR binding; IDA:UniProtKB. GO:0003729; F:mRNA binding; IDA:UniProtKB. GO:0000166; F:nucleotide binding; IEA:InterPro. GO:0003723; F:RNA binding; IEA:UniProtKB-KW. |
|
GO-P |
GO:0070935; P:3'-UTR-mediated mRNA stabilization; IDA:UniProtKB. GO:0007049; P:cell cycle; IEA:UniProtKB-KW. GO:0007050; P:cell cycle arrest; IDA:UniProtKB. GO:0030154; P:cell differentiation; IEA:UniProtKB-KW. GO:0006977; P:DNA damage response, signal |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr50093 |
PHOSPHORYLATION |
110 |
Y |
PhosphoSitePlus |
LTP |
N |
 
|
