Protein basic information
LiverAtlas Protein ID |
HuLPr50097 |
Uniprot ID |
|
Uniprot Acc |
Q4U2R6;Q96Q57;Q9BQ36;Q9P0N7; |
Protein name |
39S ribosomal protein L51, mitochondrial |
Comment |
SUBUNIT: Component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins (By similarity).||SUBCELLULAR LOCATION: Mitochondrion (By similarity). |
Subcellular localization |
Mitochondrion (By similarity). |
Gene name |
|
Protein sequence
|
MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPP PKVVDRWNEKRAMFGVYDNIGILGNFEKHPKELIRGPIW LRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLY KHFNRHGKFR |
Database cross reference |
RefSeq Protein accession:NP_057581
|
Ontology annotation
GO-C |
GO:0005762; C:mitochondrial large ribosomal subunit; ISS:UniProtKB. |
GO-F |
GO:0003735; F:structural constituent of ribosome; ISS:UniProtKB. |
GO-P |
GO:0006412; P:translation; ISS:UniProtKB. |