HuLPr50102

Uniprot ID

ROMO1_HUMAN

Uniprot Acc

P60602;A7M872;E1P5R9;Q3MHD5;Q5QP16;Q9CQ98;Q9H1N2;

Protein name

Reactive oxygen species modulator 1

Comment

FUNCTION: Induces production of reactive oxygen species (ROS) which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence.||SUBCELLULAR LOCATION: Mitochondrion membrane; Single-pass membrane protein.||ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P60602-1; Sequence=Displayed; Name=2; IsoId=P60602-2; Sequence=VSP 036486; Note=Gene prediction based on EST data;||TISSUE SPECIFICITY: Up-regulated in a number of cancer cell lines when compared to a normal lung fibroblast cell line.||DEVELOPMENTAL STAGE: Expression increases in senescent cells.||INDUCTION: By the anticancer drug fluorouracil (5FU).||MISCELLANEOUS: Enforced expression in IMR-90 cells leads to increased levels of ROS and induces premature cell senescence and nuclear DNA damage.||SIMILARITY: Belongs to the MGR2 family.

Subcellular localization

Mitochondrion membrane; Single-pass membrane protein.

Gene name

reactive oxygen species modulator 1

Protein sequence

MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTF SCLRIGMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC

Database cross reference

RefSeq Protein accession:NP_542786
RefSeq Protein gi:18152785

GO:0016021; C:integral to membrane; IEA:UniProtKB-KW. GO:0031966; C:mitochondrial membrane; IEA:UniProtKB-SubCell.

GO-P

GO:0034614; P:cellular response to reactive oxygen species; IMP:UniProtKB. GO:0008284; P:positive regulation of cell proliferation; IDA:UniProtKB. GO:2000379; P:positive regulation of reactive oxygen species metabolic process; IDA:UniProtKB. GO:0001302;