Protein basic information
LiverAtlas Protein ID |
HuLPr50127 |
Uniprot ID |
|
Uniprot Acc |
Q9BXN6;Q5JWI1; |
Protein name |
Sperm protein associated with the nucleus on the X chromosome D |
Comment |
SUBCELLULAR LOCATION: Cytoplasm (By similarity). Nucleus (By similarity). Note=Associated with nuclear craters (By similarity).||TISSUE SPECIFICITY: Detected in testis, sperm and a melanoma cell line.||DEVELOPMENTAL STAGE: Detected in round and elongating spermatids.||SIMILARITY: Belongs to the SPAN-X family. |
Subcellular localization |
Cytoplasm (By similarity). Nucleus (By similarity). Note=Associated with nuclear craters (By similarity). |
Gene name |
|
Protein sequence
|
MDKQSSAGGVKRSVPCDSNEANEMMPETSSGYSDPQPAPK KLKTSESSTILVVRYRRNFKRTSPEELVNDHARKNRINP LQMEEEEFMEIMVEIPAK |
Database cross reference |
RefSeq Protein accession:NP_115793
|
Ontology annotation
GO-C |
GO:0005737; C:cytoplasm; IEA:UniProtKB-SubCell. GO:0005634; C:nucleus; IEA:UniProtKB-SubCell. |