Protein basic information
LiverAtlas Protein ID |
HuLPr50145 |
Uniprot ID |
|
Uniprot Acc |
O75204;D3DXH0; |
Protein name |
Transmembrane protein 127 |
Comment |
FUNCTION: Controls cell proliferation acting as a negative regulator of TOR signaling pathway mediated by mTORC1. May act as a tumor suppressor.||SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein. Cytoplasm. Note=Association of TMEM127 with the cell membrane is enhanced by inhibition of endocytosis. In the cytoplasm, it colocalizes with markers of early endosomal structures, Golgi apparatus and lysosomes.||TISSUE SPECIFICITY: Widely expressed.||DISEASE: Defects in TMEM127 are a cause of susceptibility to pheochromocytoma (PCC) [MIM:171300]. A catecholamine-producing tumor of chromaffin tissue of the adrenal medulla or sympathetic paraganglia. The cardinal symptom, reflecting the increased secretion of epinephrine and norepinephrine, is hypertension, which may be persistent or intermittent.||MISCELLANEOUS: Consistent with the observation that mTORC1 signaling regulates cell growth and size in many species, TMEM127 knockdown cells are larger and proliferate at higher rates |
Subcellular localization |
Cell membrane; Multi-pass membrane protein. Cytoplasm. Note=Association of TMEM127 with the cell membrane is enhanced by inhibition of endocytosis. In the cytoplasm, it colocalizes with markers of early endosomal structures, Golgi apparatus and lysosomes. |
Gene name |
|
Protein sequence
|
MYAPGGAGLPGGRRRRSPGGSALPKQPERSLASALPGALS ITALCTALAEPAWLHIHGGTCSRQELGVSDVLGYVHPDL LKDFCMNPQTVLLLRVIAAFCFLGILCSLSAFLLDVFGP KHPALKITRRYAFAHILTVLQCATVIGFSYWASELILAQ QQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLL RHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP |
Database cross reference |
RefSeq Protein accession:NP_001180233
|
Ontology annotation
GO-C |
GO:0005737; C:cytoplasm; IDA:UniProtKB. GO:0016021; C:integral to membrane; IEA:UniProtKB-KW. GO:0005886; C:plasma membrane; IDA:UniProtKB. |
GO-P |
GO:0008285; P:negative regulation of cell proliferation; IMP:UniProtKB. GO:0032007; P:negative regulation of TOR signaling cascade; IMP:UniProtKB. |