Protein basic information
LiverAtlas Protein ID |
HuLPr50158 |
Uniprot ID |
|
Uniprot Acc |
Q9Y5Z9;B3KQG3;Q53GX3;Q5THD4; |
Protein name |
UbiA prenyltransferase domain-containing protein 1 |
Comment |
FUNCTION: Prenyltransferase that mediates the formation of menaquinone-4 (MK-4), a vitamin K2 isoform present at high concentrations in the brain, kidney and pancreas. Mediates the conversion of phylloquinone (PK) into menaquinone-4 (MK-4), probably by cleaving the side chain of phylloquinone (PK) to release 2-methyl-1,4-naphthoquinone (menadione; K3) and then prenylating it with geranylgeranyl pyrophosphate (GGPP) to form MK-4.||PATHWAY: Cofactor biosynthesis; menaquinone biosynthesis.||SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm. Nucleus. Mitochondrion.||ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y5Z9-1; Sequence=Displayed; Name=2; IsoId=Q9Y5Z9-2; Sequence=VSP 019455, VSP 019456; Note=No experimental confirmation available;||TISSUE SPECIFICITY: Ubiquitously expressed.||DISEASE: Defects in UBIAD1 are the cause of crystalline corneal dystrophy of Schnyder (SCCD) [MIM:121800]. SCCD is a rare |
Subcellular localization |
Endoplasmic reticulum membrane; Multi-pass membrane protein. Cytoplasm. Nucleus. Mitochondrion. |
Gene name |
|
Protein sequence
|
MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQR SWRQKCASYVLALRPWSFSASLTPVALGSALAYRSHGVL DPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDD RTLVDRILEPQDVVRFGVFLYTLGCVCAACLYYLSPLKL EHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGP LAVMFAYAIQVGSLAIFPLVYAIPLALSTEAILHSNNTR DMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSI LATHCTISLALPLLTIPMAFSLERQFRSQAFNKLPQRTA KLNLLLGLFYVFGIILAPAGSLPKI |
Database cross reference |
RefSeq Protein accession:NP_037451
|
Ontology annotation
GO-C |
GO:0005789; C:endoplasmic reticulum membrane; IEA:UniProtKB-SubCell. GO:0016021; C:integral to membrane; IEA:UniProtKB-KW. GO:0005739; C:mitochondrion; IEA:UniProtKB-SubCell. GO:0005634; C:nucleus; IDA:UniProtKB. |
GO-F |
GO:0004659; F:prenyltransferase activity; IDA:UniProtKB. |
GO-P |
GO:0009234; P:menaquinone biosynthetic process; IEA:UniProtKB-KW. |