Protein basic information
LiverAtlas Protein ID |
HuLPr50196 |
Uniprot ID |
|
Uniprot Acc |
Q9C002; |
Protein name |
Normal mucosa of esophagus-specific gene 1 protein |
Comment |
SUBCELLULAR LOCATION: Nucleus.||TISSUE SPECIFICITY: Expressed mainly in stomach, placenta, small intestine and colon, as well as in normal mucosa of esophagus. Down-regulated in esophageal squamous cell carcinoma.||SIMILARITY: Belongs to the complex I NDUFA4 subunit family. |
Subcellular localization |
Nucleus. |
Gene name |
|
Protein sequence
|
MSFFQLLMKRKELIPLVVFMTVAAGGASSFAVYSLWKTDV ILDRKKNPEPWETVDPTVPQKLITINQQWKPIEELQNVQ RVTK |
Database cross reference |
RefSeq Protein accession:NP_115789
|
Ontology annotation
GO-C |
GO:0005634; C:nucleus; IDA:UniProtKB. |