Protein basic information
| LiverAtlas Protein ID |
HuLPr50213 |
|
Uniprot ID |
|
|
Uniprot Acc |
Q08334;Q9BUU4; |
|
Protein name |
Interleukin-10 receptor subunit beta |
|
Comment |
FUNCTION: Receptor for IL10 and IL22. Serves as an accessory chain essential for the active IL10 receptor complex and to initiate IL10-induced signal transduction events.||SUBCELLULAR LOCATION: Membrane; Single-pass type I membrane protein.||POLYMORPHISM: Genetic variations in IL10RB influence susceptibility to hepatitis B virus (HBV) infection [MIM:610424].||DISEASE: Defects in IL10RB are the cause of inflammatory bowel disease type 25 (IBD25) [MIM:612567]. It is a chronic, relapsing inflammation of the gastrointestinal tract with a complex etiology. It is subdivided into Crohn disease and ulcerative colitis phenotypes. Crohn disease may affect any part of the gastrointestinal tract from the mouth to the anus, but most frequently it involves the terminal ileum and colon. Bowel inflammation is transmural and discontinuous; it may contain granulomas or be associated with intestinal or perianal fistulas. In contrast, in ulcerative colitis, the inflammation is continuous and limited to re |
|
Subcellular localization |
Membrane; Single-pass type I membrane protein. |
|
Gene name |
|
|
Protein sequence
|
MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQW ESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSL SKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGM QVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQ YWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLP DRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVC LALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPH HNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSC SLGTPPGQGPQS |
|
Database cross reference |
RefSeq Protein accession:NP_000619
|
Ontology annotation
| GO-C |
GO:0032002; C:interleukin-28 receptor complex; NAS:UniProtKB. |
|
GO-F |
GO:0005515; F:protein binding; IPI:UniProtKB. GO:0004872; F:receptor activity; TAS:ProtInc. |
|
GO-P |
GO:0006955; P:immune response; TAS:ProtInc. GO:0006954; P:inflammatory response; TAS:ProtInc. |
Post-translational modification
| LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
|
HuLPr50213 |
PHOSPHORYLATION |
296 |
S |
PhosphoSitePlus |
LTP |
N |
|
