HuLPr50233

Uniprot ID

VEGFA_HUMAN

Uniprot Acc

P15692;B5BU86;O60720;O75875;Q074Z4;Q16889;Q5UB46;Q6P0P5;Q96KJ0;Q96L82;Q96NW5;Q9H1W8;Q9H1W9;Q9UH58;Q9UL23;

Protein name

Vascular endothelial growth factor A

Comment

FUNCTION: Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways, does not activate angiogenesis and inhibits tumor growth.||SUBUNIT: Homodimer; disulfide-linked. Also found as heterodimer with PGF (By similarity).||INTERACTION: O14786:NRP1; NbExp=1; IntAct=EBI-1026643, EBI-1187100;||SUBCELLULAR LOCATION: Secreted. Note=VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix,

Subcellular localization

Secreted. Note=VEGF121 is acidic and freely secreted. VEGF165 is more basic, has heparin-binding properties and, although a signicant proportion remains cell-associated, most is freely secreted. VEGF189 is very basic, it is cell-associated after secretion and is bound avidly by heparin and the extracellular matrix, although it may be released as a soluble form by heparin, heparinase or plasmin.

Gene name

vascular endothelial growth factor A

Protein sequence

MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEV VKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVP LMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIG EMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKK SRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFV QDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Database cross reference

RefSeq Protein accession:NP_001020537
RefSeq Protein gi:76781480

GO:0009986; C:cell surface; IDA:BHF-UCL. GO:0005615; C:extracellular space; IDA:UniProtKB. GO:0016020; C:membrane; IEA:InterPro. GO:0031093; C:platelet alpha granule lumen; TAS:Reactome.

GO-F

GO:0043498; F:cell surface binding; IDA:BHF-UCL. GO:0042056; F:chemoattractant activity; IDA:UniProtKB. GO:0005125; F:cytokine activity; ISS:BHF-UCL. GO:0050840; F:extracellular matrix binding; IC:BHF-UCL. GO:0001968; F:fibronectin binding; IDA:BHF-UCL

GO-P

GO:0002575; P:basophil chemotaxis; IDA:UniProtKB. GO:0071456; P:cellular response to hypoxia; IDA:MGI. GO:0050930; P:induction of positive chemotaxis; IDA:UniProtKB. GO:0050930; P:induction of positive chemotaxis; NAS:UniProtKB. GO:0030168; P:platelet