Protein basic information
LiverAtlas Protein ID |
HuLPr50254 |
Uniprot ID |
|
Uniprot Acc |
Q9H1M4;Q14DW7; |
Protein name |
Beta-defensin 127 |
Comment |
FUNCTION: Has antibacterial activity (Potential).||SUBCELLULAR LOCATION: Secreted (Potential).||SIMILARITY: Belongs to the beta-defensin family. |
Subcellular localization |
Secreted (Potential). |
Gene name |
|
Protein sequence
|
MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVN EVPEALCENGRYCCLNIKELEACKKITKPPRPKPATLAL TLQDYVTIIENFPSLKTQST |
Database cross reference |
RefSeq Protein accession:NP_620713
|
Ontology annotation
GO-C |
GO:0005576; C:extracellular region; IEA:UniProtKB-SubCell. |
GO-P |
GO:0042742; P:defense response to bacterium; TAS:UniProtKB. GO:0045087; P:innate immune response; TAS:UniProtKB. |