Protein basic information
LiverAtlas Protein ID |
HuLPr50261 |
Uniprot ID |
|
Uniprot Acc |
Q96FT9;B3KPT6;B4DZI9;O95418;Q9ULA9; |
Protein name |
Intraflagellar transport protein 43 homolog |
Comment |
FUNCTION: Component of IFT complex A (IFT-A) involved in retrograde ciliary transport along microtubules from the ciliary tip to the base.||SUBUNIT: Component of IFT complex A (Probable). Interacts with WDR35/IFT121.||ALTERNATIVE PRODUCTS: Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=Q96FT9-1; Sequence=Displayed; Name=2; IsoId=Q96FT9-2; Sequence=VSP 021169; Note=No experimental confirmation available. Variant in position: 94:D->N (in dbSNP:rs17783366); Name=3; IsoId=Q96FT9-3; Sequence=VSP 041319; Note=No experimental confirmation available;||DISEASE: Defects in IFT43 are a cause of cranioectodermal dysplasia type 1 (CED1) [MIM:218330]. CED1 is a disorder characterized by craniofacial, skeletal and ectodermal abnormalities. Clinical features include dolichocephaly (with or without sagittal suture synostosis), scaphocephaly, short stature, limb shortening, short ribs, narrow chest, brachydactyly, renal failure and hepatic fibrosis, small and abnormally shaped t |
Gene name |
|
Protein sequence
|
MEDLLDLDEELRYSLATSRAKMGRRAQQESAQAENHLNGK NSSLTLTGETSSAKLPRCRQGGWAGDSVKASKFRRKASE EIEDFRLRPQSLNGSDYGGDIPIIPDLEEVQEEDFVLQV AAPPSIQIKRVMTYRDLDNDLMKYSAIQTLDGEIDLKLL TKVLAPEHEVREDDVGWDWDHLFTEVSSEVLTEWDPLQT EKEDPAGQARHT |
Database cross reference |
RefSeq Protein accession:NP_001096034
|
Ontology annotation
GO-P |
GO:0060271; P:cilium morphogenesis; IMP:UniProtKB. GO:0035721; P:intraflagellar retrograde transport; IMP:UniProtKB. |
Post-translational modification
LiverAtlas Protein ID |
MOD type1 |
Position1 |
Residue1 |
Source name1 |
source ID1 |
Source method |
HLPP validation1 (Yes/no) |
Quality score |
HuLPr50261 |
PHOSPHORYLATION |
78 |
S |
PhosphoSitePlus |
LTP |
N |